| Name | Apelin 12 FRET bundle | ||||||
| Description | For a Fluorescence Resonance Energy Transfer (FRET) application, this pair contains the FRET peptide and its control . The amount states the amount delivered of each of the two peptides. The individual peptides of this set are also available separately. | ||||||
Order
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5200-1 | 450 EUR | BUY | ||||
| 5 mg | SP-5200-5 | 1830 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 12, human may contain more information and related peptides.
Apelin 12 FRET bundle
| Name | |||||||
|---|---|---|---|---|---|---|---|
| Apelin 12 FRET | |||||||
| Apelin 12 FRET control | |||||||
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
