Name		Apelin 12, human
Sequence		RPRLSHKGPMPF
3-letter-code		Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe
Molecular weight		1422.72
Counter ion		TFA
Description		Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Apelin 12 is a 12 amino acid peptide fragment corresponding to the sequence 62-77. It is also found in bovine, rat, and mouse.

Order Apelin 12, human peptide

Amount	Cat.No.					Unit price
1 mg	SP-5121-1					80 EUR	BUY
5 mg	SP-5121-5					310 EUR	BUY
For larger amounts please inquire.

Labeled and modified Apelin 12, human

Name
Apelin 12 FRET bundle
Apelin 12, 1-10, D5		Ser 5 is replaced by Aspartic acid (Asp). Missing the two C-terminal amino acids Pro Phe of Apelin 12.
Apelin 12, 1-10, I4		Leu 4 is replaced by Isoleucine (Ile). Missing the two C-terminal amino acids Pro Phe of Apelin 12.
Apelin 12, 1-10, K3		Arg 3 is replaced by Lysine (Lys). Missing the two C-terminal amino acids Pro Phe of Apelin 12.
Apelin 12, 1-10, K3, D5		Arg 3 is replaced by Lysine (Lys), Ser 5 is replaced by Aspartic acid (Asp). Missing the two C-terminal amino acids Pro Phe of Apelin 12.
Apelin 12, 1-10, K6		His 6 is replaced by Lysine (Lys). Missing the two C-terminal amino acids Pro Phe of Apelin 12.

Apelin 12, human antibody

Please inquire for pricing and availability.

Related peptides

Name		Sequence
Apelin 13, Pyr1, human		(Pyr)RPRLSHKGPMPF
Apelin 17, human		KFRRQRPRLSHKGPMPF
Apelin 36, human		LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF