Apelin peptides

Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Innovagen currently provides a range of these fragments and their analogues.

Apelin 12, human

Sequence: RPRLSHKGPMPF
More details, peptide analogues, modifications, related peptides, etc.

Order Apelin 12, human peptide

Amount Cat.No.        Unit price    
  1 mg SP-5121-1 80 EUR   BUY
  5 mg SP-5121-5 310 EUR   BUY
 
For larger amounts please inquire.  

Apelin 13, Pyr1, human

Sequence: (Pyr)RPRLSHKGPMPF
More details, peptide analogues, modifications, related peptides, etc.

Order Apelin 13, Pyr1, human peptide

Amount Cat.No.        Unit price    
  1 mg SP-5120-1 80 EUR   BUY
  5 mg SP-5120-5 310 EUR   BUY
 
For larger amounts please inquire.  

Apelin 17, human

Sequence: KFRRQRPRLSHKGPMPF
More details, peptide analogues, modifications, related peptides, etc.

Order Apelin 17, human peptide

Amount Cat.No.        Unit price    
  1 mg SP-5119-1 100 EUR   BUY
  5 mg SP-5119-5 390 EUR   BUY
 
For larger amounts please inquire.  

Apelin 36, human

Sequence: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
More details, peptide analogues, modifications, related peptides, etc.

Order Apelin 36, human peptide

Amount Cat.No.        Unit price    
  1 mg SP-5118-1 260 EUR   BUY
  5 mg SP-5118-5 1030 EUR   BUY
 
For larger amounts please inquire.  




Apelin 12 FRET peptides

For a Fluorescence Resonance Energy Transfer (FRET) application, this pair contains the FRET peptide and its control. The amount states the amount delivered of each of the two peptides. The individual peptides of this set are also available separately.

Order Alanine 12 FRET pair

Amount Cat.No.        Unit price    
  1 mg SP-5200-1 450 EUR   BUY
  5 mg SP-5200-5 1830 EUR   BUY
 
For larger amounts please inquire.  

Name   Sequence         Info
Apelin 12 FRET (MCA-) RPRLSHKGPMP(Dap-Dnp) -amide More info
Apelin 12 FRET control (MCA-) RPRLSHKGPMP -amide More info

Apelin 12 analogues

Name   Sequence         Info
Apelin 12, 1-10, D5 RPRLDHKGPM More info
Apelin 12, 1-10, I4 RPRISHKGPM More info
Apelin 12, 1-10, K3 RPKLSHKGPM More info
Apelin 12, 1-10, K3, D5 RPKLDHKGPM More info
Apelin 12, 1-10, K6 RPRLSKKGPM More info



Apelin 13 Alanine scan

This set of twelve peptides forms a complete Alanine scan of Apelin 13. The amount states the amount delivered of each of the twelve peptides. Each of the individual peptides of this set is also available separately.

Order Alanine scan peptide set

Amount Cat.No.        Unit price    
  1 mg SP-5128-1 890 EUR   BUY
 
For larger amounts please inquire.  

Name   Sequence         Info
Apelin 13, Pyr1, A02 (Pyr)APRLSHKGPMPF -amide More info
Apelin 13, Pyr1, A03 (Pyr)RARLSHKGPMPF -amide More info
Apelin 13, Pyr1, A04 (Pyr)RPALSHKGPMPF -amide More info
Apelin 13, Pyr1, A05 (Pyr)RPRASHKGPMPF -amide More info
Apelin 13, Pyr1, A06 (Pyr)RPRASHKGPMPF -amide More info
Apelin 13, Pyr1, A07 (Pyr)RPRLSAKGPMPF -amide More info
Apelin 13, Pyr1, A08 (Pyr)RPRLSHAGPMPF -amide More info
Apelin 13, Pyr1, A09 (Pyr)RPRLSHKAPMPF -amide More info
Apelin 13, Pyr1, A10 (Pyr)RPRLSHKGAMPF -amide More info
Apelin 13, Pyr1, A11 (Pyr)RPRLSHKGPAPF -amide More info
Apelin 13, Pyr1, A12 (Pyr)RPRLSHKGPMAF -amide More info
Apelin 13, Pyr1, A13 (Pyr)RPRLSHKGPMPA -amide More info

Apelin 13 labelled with stable isotopes 13C/15N

Pro 3 and Pro 12 of these Apelin 13 peptides are labelled with the stable isotopes 13C/15N, adding a total of 12 Da to the molecular weight of the labelled peptides.

Apelin 13, Pyr1, 13C/15N

Sequence: (Pyr)RP*RLSHKGPMP*F
More details.

Order Apelin 13, Pyr1, 13C/15N peptide

Amount Cat.No.        Unit price    
  0.1 mg SP-5197-01 370 EUR   BUY
  0.5 mg SP-5197-05 740 EUR   BUY
  1 mg SP-5197-1 920 EUR   BUY
 
For larger amounts please inquire.  

Apelin 13, Pyr1, 13C/15N, 5dL

Sequence: (Pyr)RP*R(dL)SHKGPMP*F
More details.

Order Apelin 13, Pyr1, 13C/15N, 5dL peptide

Amount Cat.No.        Unit price    
  0.1 mg SP-5199-01 370 EUR   BUY
  0.5 mg SP-5199-05 740 EUR   BUY
  1 mg SP-5199-1 920 EUR   BUY
 
For larger amounts please inquire.  

Apelin 13, Pyr1, 13C/15N, 6dS

Sequence: (Pyr)RP*RL(dS)HKGPMP*F
More details.

Order Apelin 13, Pyr1, 13C/15N, 6dS peptide

Amount Cat.No.        Unit price    
  0.1 mg SP-5198-01 370 EUR   BUY
  0.5 mg SP-5198-05 740 EUR   BUY
  1 mg SP-5198-1 920 EUR   BUY
 
For larger amounts please inquire.  


Apelin 13 N-terminal fatty acid

Apelin 13, lauroyl

Sequence: QRPRLSHKGPMPF
More details.

Order Apelin 13, lauroyl peptide

Amount Cat.No.        Unit price    
  1 mg SP-5125-1 160 EUR   BUY
  5 mg SP-5125-5 630 EUR   BUY
 
For larger amounts please inquire.  

Apelin 13, myristoyl

Sequence: QRPRLSHKGPMPF
More details.

Order Apelin 13, myristoyl peptide

Amount Cat.No.        Unit price    
  1 mg SP-5126-1 160 EUR   BUY
  5 mg SP-5126-5 630 EUR   BUY
 
For larger amounts please inquire.  

Apelin 13, palmitoyl

Sequence: QRPRLSHKGPMPF
More details.

Order Apelin 13, palmitoyl peptide

Amount Cat.No.        Unit price    
  1 mg SP-5124-1 160 EUR   BUY
  5 mg SP-5124-5 630 EUR   BUY
 
For larger amounts please inquire.  

Apelin 13, stearoyl

Sequence: QRPRLSHKGPMPF
More details.

Order Apelin 13, stearoyl peptide

Amount Cat.No.        Unit price    
  1 mg SP-5127-1 160 EUR   BUY
  5 mg SP-5127-5 630 EUR   BUY
 
For larger amounts please inquire.  


Apelin 13 analogues

Name   Sequence         Info
Apelin 13, H1, K7 HRPRLSKKGPMPF More info
Apelin 13, Pyr1, 13C/15N (Pyr)RP*RLSHKGPMP*F More info
Apelin 13, Pyr1, 13C/15N, 5dL (Pyr)RP*R(dL)SHKGPMP*F More info
Apelin 13, Pyr1, 13C/15N, 6dS (Pyr)RP*RL(dS)HKGPMP*F More info
Apelin 13, Pyr1, C11 (Pyr)RPRLSHKGPCPF More info
Apelin 13, Pyr1, C6 (Pyr)RPRLCHKGPMPF More info
Apelin 13, Pyr1, D6 (Pyr)RPRLDHKGPMPF More info
Apelin 13, Pyr1, D6, I12 (Pyr)RPRLDHKGPMIF More info
Apelin 13, Pyr1, D6, K7 (Pyr)RPRLDKKGPMPF More info
Apelin 13, Pyr1, D6, K7, T12 (Pyr)RPRLDKKGPMTF More info
Apelin 13, Pyr1, D6, T12 (Pyr)RPRLDHKGPMTF More info
Apelin 13, Pyr1, dL5, D6 (Pyr)RPR(dL)DHKGPMPF More info
Apelin 13, Pyr1, dL5, D6, T12 (Pyr)RPR(dL)DHKGPMTF More info
Apelin 13, Pyr1, dL5, D6, Y13 (Pyr)RPR(dL)DHKGPMPY More info
Apelin 13, Pyr1, dL5D6T12Y13 (Pyr)RPR(dL)DHKGPMTY More info
Apelin 13, Pyr1, E2 (Pyr)EPRLSHKGPMPF More info
Apelin 13, Pyr1, E4 (Pyr)RPELSHKGPMPF More info
Apelin 13, Pyr1, F11 (Pyr)RPRLSHKGPFPF More info
Apelin 13, Pyr1, F5 (Pyr)RPRFSHKGPMPF More info
Apelin 13, Pyr1, F7 (Pyr)RPRLSFKGPMPF More info
Apelin 13, Pyr1, H8 (Pyr)RPRLSHHGPMPF More info
Apelin 13, Pyr1, I12 (Pyr)RPRLSHKGPMIF More info
Apelin 13, Pyr1, I5 (Pyr)RPRISHKGPMPF More info
Apelin 13, Pyr1, I5, D6 (Pyr)RPRIDHKGPMPF More info
Apelin 13, Pyr1, I5, I12 (Pyr)RPRISHKGPMIF More info
Apelin 13, Pyr1, I5, K7 (Pyr)RPRISHKGPMPF More info
Apelin 13, Pyr1, I5, Y13 (Pyr)RPRISHKGPMPY More info
Apelin 13, Pyr1, K4, D6 (Pyr)RPKLDHKGPMPF More info
Apelin 13, Pyr1, K4, D6, T12 (Pyr)RPKLDHKGPMTF More info
Apelin 13, Pyr1, K4, dL5, Y13 (Pyr)RPK(dL)SHKGPMPY More info
Apelin 13, Pyr1, K4, I12 (Pyr)RPKLSHKGPMIF More info
Apelin 13, Pyr1, K4, I5 (Pyr)RPKISHKGPMPF More info
Apelin 13, Pyr1, K4, T12 (Pyr)RPKLSHKGPMTF More info
Apelin 13, Pyr1, K4, Y13 (Pyr)RPKLSHKGPMPY More info
Apelin 13, Pyr1, K7 (Pyr)RPRLSKKGPMPF More info
Apelin 13, Pyr1, K7, I12 (Pyr)RPRLSKKGPMIF More info
Apelin 13, Pyr1, K7, Y13 (Pyr)RPRLSKKGPMPY More info
Apelin 13, Pyr1, L13 (Pyr)RPRLSHKGPMPL More info
Apelin 13, Pyr1, N11 (Pyr)RPRLSHKGPNPF More info
Apelin 13, Pyr1, P7 (Pyr)RPRLSPKGPMPF More info
Apelin 13, Pyr1, R7 (Pyr)RPRLSRKGPMPF More info
Apelin 13, Pyr1, S9 (Pyr)RPRLSHKSPMPF More info
Apelin 13, Pyr1, T12 (Pyr)RPRLSHKGPMTF More info
Apelin 13, Pyr1, T6 (Pyr)RPRLTHKGPMPF More info
Apelin 13, Pyr1, V5 (Pyr)RPRFSHKGPMPF More info
Apelin 13, Pyr1, V6 (Pyr)RPRLVHKGPMPF More info
Apelin 13, Pyr1, Y6 (Pyr)RPRLYHKGPMPF More info
Apelin 13, Pyr1, Y7 (Pyr)RPRLSYKGPMPF More info