Apelin 13, Pyr1, 13C/15N peptide
| Name | Apelin 13, Pyr1, 13C/15N | ||||||
| Sequence | (Pyr)RP*RLSHKGPMP*F | ||||||
| 3-letter-code | Pyr - Arg - Pro* - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro* - Phe | ||||||
| Notes | Pro 3 and Pro 12 are labelled with the stable isotopes 13C/15N, adding a total of 12 Da to the molecular weight of the peptide. | ||||||
| Molecular weight | 1545.93 | ||||||
Order Apelin 13, Pyr1, 13C/15N peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 0.1 mg | SP-5197-01 | 370 EUR | BUY | ||||
| 0.5 mg | SP-5197-05 | 740 EUR | BUY | ||||
| 1 mg | SP-5197-1 | 920 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
