Apelin 13, Pyr1, C6 peptide
| Name | Apelin 13, Pyr1, C6 | ||||||
| Sequence | (Pyr)RPRLCHKGPMPF | ||||||
| 3-letter-code | Pyr - Arg - Pro - Arg - Leu - Cys - His - Lys - Gly - Pro - Met - Pro - Phe | ||||||
| Notes | Ser 6 is replaced by Cysteine (Cys). | ||||||
| Molecular weight | 1549.89 | ||||||
Order Apelin 13, Pyr1, C6 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5164-1 | 80 EUR | BUY | ||||
| 5 mg | SP-5164-5 | 310 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
