Apelin 13, Pyr1, F7 peptide
Name | Apelin 13, Pyr1, F7 | ||||||
Sequence | (Pyr)RPRLSFKGPMPF | ||||||
3-letter-code | Pyr - Arg - Pro - Arg - Leu - Ser - Phe - Lys - Gly - Pro - Met - Pro - Phe | ||||||
Notes | His 7 is replaced by Phenylalanine (Phe). | ||||||
Molecular weight | 1543.86 | ||||||
Order Apelin 13, Pyr1, F7 peptide
Amount | Cat.No. | Unit price | |||||
---|---|---|---|---|---|---|---|
1 mg | SP-5152-1 | 80 EUR | BUY | ||||
5 mg | SP-5152-5 | 310 EUR | BUY | ||||
For larger amounts please inquire. |
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
Name | Sequence | ||||||
---|---|---|---|---|---|---|---|
Apelin 12, human | RPRLSHKGPMPF | ||||||
Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |